Lineage for d2iyya1 (2iyy A:2-166)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695443Family c.37.1.2: Shikimate kinase (AroK) [52566] (1 protein)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
  6. 695444Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 695458Species Mycobacterium tuberculosis [TaxId:1773] [75194] (19 PDB entries)
  8. 695463Domain d2iyya1: 2iyy A:2-166 [137815]
    automatically matched to d1l4ua_
    complexed with cl, mg, po4, s3p, so4

Details for d2iyya1

PDB Entry: 2iyy (more details), 1.62 Å

PDB Description: shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and so4
PDB Compounds: (A:) Shikimate kinase

SCOP Domain Sequences for d2iyya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iyya1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrl

SCOP Domain Coordinates for d2iyya1:

Click to download the PDB-style file with coordinates for d2iyya1.
(The format of our PDB-style files is described here.)

Timeline for d2iyya1: