SCOPe 2.05: Domain d2iync_: 2iyn C:

Lineage for d2iync_ (2iyn C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186909] (4 PDB entries)

8. Domain d2iync_: 2iyn C: [137805]
   automated match to d1b00a_
   complexed with mg

Details for d2iync_

PDB Entry: 2iyn, 2.08 Å

PDB Description: the co-factor-induced pre-active conformation in phob

PDB Compounds: (C:) phosphate regulon transcriptional regulatory protein phob

SCOPe Domain Sequences for d2iync_:

Sequence, based on SEQRES records:

>d2iync_ c.23.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
qfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmrr

Sequence, based on observed residues (ATOM records):

>d2iync_ c.23.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
qfikhlkresmtrdipvvmltatgaddyitkpfspkelvarikavmrr

Timeline for d2iync_:

• d2iync_ first appeared in SCOP 1.73, called d2iync1
  
• d2iync_ appears in SCOPe 2.04
  
• d2iync_ appears in SCOPe 2.06
  
• d2iync_ appears in the current release, SCOPe 2.08