SCOPe 2.02: Domain d2iydb1: 2iyd B:14-92

Lineage for d2iydb1 (2iyd B:14-92)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein SUMO-2 [117816] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117817] (9 PDB entries)
   Uniprot P61956

8. Domain d2iydb1: 2iyd B:14-92 [137800]
   automatically matched to 2CKH B:14-92

Details for d2iydb1

PDB Entry: 2iyd, 3.2 Å

PDB Description: senp1 covalent complex with sumo-2

PDB Compounds: (B:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d2iydb1:

Sequence; same for both SEQRES and ATOM records:

>d2iydb1 d.15.1.1 (B:14-92) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa
qlemededtidvfqqqtgg

Timeline for d2iydb1:

• d2iydb1 first appeared in SCOP 1.73
  
• d2iydb1 appears in SCOPe 2.01
  
• d2iydb1 appears in SCOPe 2.03
  
• d2iydb1 appears in the current release, SCOPe 2.08