Lineage for d2ixnb1 (2ixn B:3-299)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781135Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 781136Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
  5. 781137Family a.268.1.1: PTPA-like [140985] (1 protein)
    Pfam PF03095
  6. 781138Protein Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA [140986] (2 species)
  7. 781139Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140988] (3 PDB entries)
    Uniprot Q12461 2-317! Uniprot Q12461 3-299
  8. 781143Domain d2ixnb1: 2ixn B:3-299 [137778]
    automatically matched to 2IXN A:3-299

Details for d2ixnb1

PDB Entry: 2ixn (more details), 2.8 Å

PDB Description: crystal structure of the pp2a phosphatase activator ypa2 ptpa2
PDB Compounds: (B:) serine/threonine-protein phosphatase 2a activator 2

SCOP Domain Sequences for d2ixnb1:

Sequence, based on SEQRES records: (download)

>d2ixnb1 a.268.1.1 (B:3-299) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pekrlltpddmklweesptrahftkfiidlaesvkghensqykepisesinsmmnllsqi
kditqkhpvikdadssrfgkvefrdfydevsrnsrkilrsefpsltdeqleqlsiyldes
wgnkrridygsghelnfmcllyglysygifnlsndstnlvlkvfieylkimriletkywl
epagshgvwglddyhflpflfgafqltthkhlkpisihnnelvemfahrylyfgciafin
kvkssaslrwhspmlddisgvktwskvaegmikmykaevlsklpimqhfyfseflpc

Sequence, based on observed residues (ATOM records): (download)

>d2ixnb1 a.268.1.1 (B:3-299) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pekrlltpddmklweesptrahftkfiidlaesvkghensqykepisesinsmmnllsqi
kditqkhpviksrfgkvefrdfydevsrnsrkilrsefpsltdeqleqlsiyldeswgnk
rridygsghelnfmcllyglysygifnlsndstnlvlkvfieylkimriletkywlepag
sglddyhflpflfgafqltthkhlkpisihnnelvemfahrylyfgciafinkvkslrwh
spmlddisgvktwskvaegmikmykaevlsklpimqhfyfseflpc

SCOP Domain Coordinates for d2ixnb1:

Click to download the PDB-style file with coordinates for d2ixnb1.
(The format of our PDB-style files is described here.)

Timeline for d2ixnb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ixna1