Lineage for d2iwgd1 (2iwg D:237-341)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293085Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1293086Species Human (Homo sapiens) [TaxId:9606] [88585] (33 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1293104Domain d2iwgd1: 2iwg D:237-341 [137754]
    Other proteins in same PDB: d2iwga2, d2iwgb1, d2iwgd2, d2iwge_
    automated match to d1l6xa1
    protein/DNA complex; protein/RNA complex; complexed with fu4

Details for d2iwgd1

PDB Entry: 2iwg (more details), 2.35 Å

PDB Description: complex between the pryspry domain of trim21 and igg fc
PDB Compounds: (D:) ig gamma-1 chain c

SCOPe Domain Sequences for d2iwgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwgd1 b.1.1.2 (D:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d2iwgd1:

Click to download the PDB-style file with coordinates for d2iwgd1.
(The format of our PDB-style files is described here.)

Timeline for d2iwgd1: