![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88585] (28 PDB entries) Uniprot P01857 #118-327 Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
![]() | Domain d2iwgd1: 2iwg D:237-339 [137754] Other proteins in same PDB: d2iwga2, d2iwgb1, d2iwgd2, d2iwge1 automatically matched to d1hzhh3 complexed with fu4, gal, man, nag |
PDB Entry: 2iwg (more details), 2.35 Å
SCOP Domain Sequences for d2iwgd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iwgd1 b.1.1.2 (D:237-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska
Timeline for d2iwgd1:
![]() Domains from other chains: (mouse over for more information) d2iwga1, d2iwga2, d2iwgb1, d2iwge1 |