Lineage for d2iwgd1 (2iwg D:237-339)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655804Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 655805Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries)
  8. 655814Domain d2iwgd1: 2iwg D:237-339 [137754]
    Other proteins in same PDB: d2iwga2, d2iwgd2
    automatically matched to d1hzhh3
    complexed with fu4, gal, man, nag

Details for d2iwgd1

PDB Entry: 2iwg (more details), 2.35 Å

PDB Description: complex between the pryspry domain of trim21 and igg fc
PDB Compounds: (D:) ig gamma-1 chain c

SCOP Domain Sequences for d2iwgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwgd1 b.1.1.2 (D:237-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOP Domain Coordinates for d2iwgd1:

Click to download the PDB-style file with coordinates for d2iwgd1.
(The format of our PDB-style files is described here.)

Timeline for d2iwgd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iwgd2