Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
Domain d2iwga2: 2iwg A:342-443 [137753] Other proteins in same PDB: d2iwga1, d2iwgb1, d2iwgd1, d2iwge2, d2iwge3 automated match to d1l6xa2 protein/DNA complex; protein/RNA complex; complexed with fuc |
PDB Entry: 2iwg (more details), 2.35 Å
SCOPe Domain Sequences for d2iwga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iwga2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl
Timeline for d2iwga2: