Lineage for d2iwga2 (2iwg A:342-443)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748634Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2748637Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2748686Domain d2iwga2: 2iwg A:342-443 [137753]
    Other proteins in same PDB: d2iwga1, d2iwgb1, d2iwgd1, d2iwge2, d2iwge3
    automated match to d1l6xa2
    protein/DNA complex; protein/RNA complex; complexed with fuc

Details for d2iwga2

PDB Entry: 2iwg (more details), 2.35 Å

PDB Description: complex between the pryspry domain of trim21 and igg fc
PDB Compounds: (A:) ig gamma-1 chain c

SCOPe Domain Sequences for d2iwga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwga2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOPe Domain Coordinates for d2iwga2:

Click to download the PDB-style file with coordinates for d2iwga2.
(The format of our PDB-style files is described here.)

Timeline for d2iwga2: