SCOPe 2.03: Domain d2iwga1: 2iwg A:237-341

Lineage for d2iwga1 (2iwg A:237-341)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (33 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d2iwga1: 2iwg A:237-341 [137752]
   Other proteins in same PDB: d2iwga2, d2iwgb1, d2iwgd2, d2iwge_
   automated match to d1l6xa1
   protein/DNA complex; protein/RNA complex; complexed with fu4

Details for d2iwga1

PDB Entry: 2iwg, 2.35 Å

PDB Description: complex between the pryspry domain of trim21 and igg fc

PDB Compounds: (A:) ig gamma-1 chain c

SCOPe Domain Sequences for d2iwga1:

Sequence; same for both SEQRES and ATOM records:

>d2iwga1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Timeline for d2iwga1:

• d2iwga1 first appeared in SCOP 1.73
  
• d2iwga1 appears in SCOPe 2.02
  
• d2iwga1 appears in SCOPe 2.04
  
• d2iwga1 appears in the current release, SCOPe 2.08