SCOP 1.73: Domain d2iwga1: 2iwg A:237-339

Lineage for d2iwga1 (2iwg A:237-339)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries)

8. Domain d2iwga1: 2iwg A:237-339 [137752]
   Other proteins in same PDB: d2iwga2, d2iwgd2
   automatically matched to d1hzhh3
   complexed with fu4, gal, man, nag

Details for d2iwga1

PDB Entry: 2iwg, 2.35 Å

PDB Description: complex between the pryspry domain of trim21 and igg fc

PDB Compounds: (A:) ig gamma-1 chain c

SCOP Domain Sequences for d2iwga1:

Sequence; same for both SEQRES and ATOM records:

>d2iwga1 b.1.1.2 (A:237-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d2iwga1:

• d2iwga1 is new in SCOP 1.73
  
• d2iwga1 appears in SCOP 1.75
  
• d2iwga1 appears in the current release, SCOPe 2.08