Lineage for d2iw9b2 (2iw9 B:310-432)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495403Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1495404Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1495405Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1495418Protein Cyclin A [47956] (2 species)
  7. 1495454Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries)
    Uniprot P20248 175-432
  8. 1495472Domain d2iw9b2: 2iw9 B:310-432 [137749]
    Other proteins in same PDB: d2iw9a_, d2iw9c_
    automated match to d1oi9b2
    complexed with 4sp, mg, sgm

Details for d2iw9b2

PDB Entry: 2iw9 (more details), 2 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a complexed with a bisanilinopyrimidine inhibitor
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d2iw9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iw9b2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d2iw9b2:

Click to download the PDB-style file with coordinates for d2iw9b2.
(The format of our PDB-style files is described here.)

Timeline for d2iw9b2: