SCOP 1.73: Domain d2iv9b1: 2iv9 B:705-824

Lineage for d2iv9b1 (2iv9 B:705-824)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families)
   contains an additional N-terminal strand

5. Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
   ear domain consists of two different subdomains

6. Protein Beta2-adaptin AP2 ear domain, N-terminal subdomain [49352] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49353] (4 PDB entries)

8. Domain d2iv9b1: 2iv9 B:705-824 [137721]
   Other proteins in same PDB: d2iv9a2, d2iv9b2
   automatically matched to d1e42a1
   complexed with so4

Details for d2iv9b1

PDB Entry: 2iv9, 1.9 Å

PDB Description: b2-appendage from ap2 in complex with eps15 peptide

PDB Compounds: (B:) ap-2 complex subunit beta-2

SCOP Domain Sequences for d2iv9b1:

Sequence; same for both SEQRES and ATOM records:

>d2iv9b1 b.1.10.1 (B:705-824) Beta2-adaptin AP2 ear domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv
ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv

Timeline for d2iv9b1:

• d2iv9b1 is new in SCOP 1.73
  
• d2iv9b1 appears in SCOP 1.75
  
• d2iv9b1 appears in the current release, SCOPe 2.08