Lineage for d2iv8a2 (2iv8 A:825-937)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730921Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 730922Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) (S)
  5. 730923Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)
  6. 730935Protein Beta2-adaptin AP2, C-terminal subdomain [55715] (1 species)
  7. 730936Species Human (Homo sapiens) [TaxId:9606] [55716] (4 PDB entries)
  8. 730942Domain d2iv8a2: 2iv8 A:825-937 [137718]
    Other proteins in same PDB: d2iv8a1
    automatically matched to d1e42a2

Details for d2iv8a2

PDB Entry: 2iv8 (more details), 2.8 Å

PDB Description: beta appendage in complex with b-arrestin peptide
PDB Compounds: (A:) AP-2 complex subunit beta-1

SCOP Domain Sequences for d2iv8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iv8a2 d.105.1.1 (A:825-937) Beta2-adaptin AP2, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn

SCOP Domain Coordinates for d2iv8a2:

Click to download the PDB-style file with coordinates for d2iv8a2.
(The format of our PDB-style files is described here.)

Timeline for d2iv8a2: