SCOP 1.73: Domain d2iuza1: 2iuz A:39-298,A:361-433

Lineage for d2iuza1 (2iuz A:39-298,A:361-433)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.5: Type II chitinase [51534] (14 proteins)
   glycosylase family 18

6. Protein Chitinase 1 [51548] (2 species)

7. Species Aspergillus fumigatus [TaxId:5085] [117368] (9 PDB entries)

8. Domain d2iuza1: 2iuz A:39-298,A:361-433 [137710]
   Other proteins in same PDB: d2iuza2, d2iuzb2
   automatically matched to 1W9V A:39-298,A:361-433
   complexed with d1h, so4

Details for d2iuza1

PDB Entry: 2iuz, 1.95 Å

PDB Description: crystal structure of aspergillus fumigatus chitinase b1 in complex with c2-dicaffeine

PDB Compounds: (A:) chitinase

SCOP Domain Sequences for d2iuza1:

Sequence; same for both SEQRES and ATOM records:

>d2iuza1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas
pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt
vvnalggtgvfeqsqneldypvsqydnlrngmqt

Timeline for d2iuza1:

• d2iuza1 is new in SCOP 1.73
  
• d2iuza1 appears in SCOP 1.75
  
• d2iuza1 appears in the current release, SCOPe 2.08