SCOPe 2.03: Domain d2ispa2: 2isp A:92-148

Lineage for d2ispa2 (2isp A:92-148)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81575] (132 PDB entries)

8. Domain d2ispa2: 2isp A:92-148 [137610]
   Other proteins in same PDB: d2ispa1, d2ispa3
   automated match to d1tv9a2
   protein/DNA complex; complexed with cl, ggh, mg, na

Details for d2ispa2

PDB Entry: 2isp, 2.2 Å

PDB Description: Ternary complex of DNA Polymerase beta with a dideoxy terminated primer and 2'-deoxyguanosine 5'-beta, gamma-methylene triphosphate

PDB Compounds: (A:) Polymerase (DNA directed), beta

SCOPe Domain Sequences for d2ispa2:

Sequence; same for both SEQRES and ATOM records:

>d2ispa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

Timeline for d2ispa2:

• d2ispa2 first appeared in SCOP 1.73
  
• d2ispa2 appears in SCOPe 2.02
  
• d2ispa2 appears in SCOPe 2.04
  
• d2ispa2 appears in the current release, SCOPe 2.08