![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
![]() | Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins) |
![]() | Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [50229] (11 PDB entries) |
![]() | Domain d2ipkd1: 2ipk D:1-121 [137581] Other proteins in same PDB: d2ipka1, d2ipka2, d2ipkb1, d2ipkb2, d2ipkd2 automatically matched to d1jwmd1 complexed with 4dp, ace; mutant |
PDB Entry: 2ipk (more details), 2.3 Å
SCOP Domain Sequences for d2ipkd1:
Sequence, based on SEQRES records: (download)
>d2ipkd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]} esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg n
>d2ipkd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]} esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn ydkvktellnedlakkykdevvdvygsnyyvncyfsskggktcmyggitkhegn
Timeline for d2ipkd1:
![]() Domains from other chains: (mouse over for more information) d2ipka1, d2ipka2, d2ipkb1, d2ipkb2 |