SCOP 1.75: Domain d2ipkb2: 2ipk B:1-92

Lineage for d2ipkb2 (2ipk B:1-92)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (12 PDB entries)

8. Domain d2ipkb2: 2ipk B:1-92 [137580]
   Other proteins in same PDB: d2ipka1, d2ipka2, d2ipkb1, d2ipkd1, d2ipkd2
   automatically matched to d1d5xb2
   complexed with 4dp, ace; mutant

Details for d2ipkb2

PDB Entry: 2ipk, 2.3 Å

PDB Description: crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3- dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d2ipkb2:

Sequence; same for both SEQRES and ATOM records:

>d2ipkb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d2ipkb2:

• d2ipkb2 first appeared in SCOP 1.73
  
• d2ipkb2 appears in SCOPe 2.01
  
• d2ipkb2 appears in the current release, SCOPe 2.08