| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
| Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries) |
| Domain d2ipkb2: 2ipk B:1-92 [137580] Other proteins in same PDB: d2ipka1, d2ipka2, d2ipkb1, d2ipkd1, d2ipkd2 automatically matched to d1d5xb2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2ipk (more details), 2.3 Å
SCOPe Domain Sequences for d2ipkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ipkb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq
Timeline for d2ipkb2:
View in 3DDomains from other chains: (mouse over for more information) d2ipka1, d2ipka2, d2ipkd1, d2ipkd2 |