Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries) |
Domain d2ipka2: 2ipk A:13-81 [137578] Other proteins in same PDB: d2ipka1, d2ipkb1, d2ipkb2, d2ipkd1, d2ipkd2 automatically matched to d1k2da2 |
PDB Entry: 2ipk (more details), 2.3 Å
SCOPe Domain Sequences for d2ipka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ipka2 d.19.1.1 (A:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]} ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei mtkrsnytp
Timeline for d2ipka2:
View in 3D Domains from other chains: (mouse over for more information) d2ipkb1, d2ipkb2, d2ipkd1, d2ipkd2 |