SCOPe 2.01: Domain d2ipka2: 2ipk A:13-81

Lineage for d2ipka2 (2ipk A:13-81)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries)

8. Domain d2ipka2: 2ipk A:13-81 [137578]
   Other proteins in same PDB: d2ipka1, d2ipkb1, d2ipkb2, d2ipkd1, d2ipkd2
   automatically matched to d1k2da2

Details for d2ipka2

PDB Entry: 2ipk, 2.3 Å

PDB Description: crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3- dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2ipka2:

Sequence; same for both SEQRES and ATOM records:

>d2ipka2 d.19.1.1 (A:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp

Timeline for d2ipka2:

• d2ipka2 first appeared in SCOP 1.73
  
• d2ipka2 appears in SCOP 1.75
  
• d2ipka2 appears in SCOPe 2.02
  
• d2ipka2 appears in the current release, SCOPe 2.08