Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.7: Glutathionylspermidine synthase substrate-binding domain-like [142119] (1 protein) central part of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase |
Protein Glutathionylspermidine synthase, synthetase domain [142120] (1 species) |
Species Escherichia coli [TaxId:562] [142121] (5 PDB entries) Uniprot P0AES0 379-496 |
Domain d2io8a1: 2io8 A:379-496 [137549] Other proteins in same PDB: d2io8a2, d2io8a3, d2io8b2, d2io8b3 automatically matched to 2IO7 A:379-496 complexed with adp, cys, mg |
PDB Entry: 2io8 (more details), 2.1 Å
SCOPe Domain Sequences for d2io8a1:
Sequence, based on SEQRES records: (download)
>d2io8a1 c.30.1.7 (A:379-496) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]} rpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidgegrlvncv wktwawetafdqirevsdrefaavpirtghpqnevrlidvllrpevlvfeplwtvipg
>d2io8a1 c.30.1.7 (A:379-496) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]} rpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidgegrlvncv wktwawetafdqirevefaavpirtghpqnevrlidvllrpevlvfeplwtvipg
Timeline for d2io8a1: