SCOPe 2.01: Domain d2io1f_: 2io1 F:

Lineage for d2io1f_ (2io1 F:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (22 PDB entries)

8. Domain d2io1f_: 2io1 F: [137539]
   Other proteins in same PDB: d2io1a_, d2io1c_, d2io1e_
   automated match to d1wm2a_

Details for d2io1f_

PDB Entry: 2io1, 2.6 Å

PDB Description: crystal structure of human senp2 in complex with presumo-3

PDB Compounds: (F:) Small ubiquitin-related modifier 3 precursor

SCOPe Domain Sequences for d2io1f_:

Sequence; same for both SEQRES and ATOM records:

>d2io1f_ d.15.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
lemededtidvfqqqtggvpe

Timeline for d2io1f_:

• d2io1f_ first appeared in SCOP 1.73, called d2io1f1
  
• d2io1f_ was called d2io1f1 in SCOP 1.75
  
• d2io1f_ appears in SCOPe 2.02
  
• d2io1f_ appears in the current release, SCOPe 2.08