Lineage for d2io1f1 (2io1 F:15-88)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 853598Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 853712Protein SUMO-2 [117816] (1 species)
  7. 853713Species Human (Homo sapiens) [TaxId:9606] [117817] (11 PDB entries)
    Uniprot P61956
  8. 853720Domain d2io1f1: 2io1 F:15-88 [137539]
    Other proteins in same PDB: d2io1a1, d2io1c1, d2io1e1
    automatically matched to d1wm2a_
    mutant

Details for d2io1f1

PDB Entry: 2io1 (more details), 2.6 Å

PDB Description: crystal structure of human senp2 in complex with presumo-3
PDB Compounds: (F:) Small ubiquitin-related modifier 3 precursor

SCOP Domain Sequences for d2io1f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io1f1 d.15.1.1 (F:15-88) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
lemededtidvfqq

SCOP Domain Coordinates for d2io1f1:

Click to download the PDB-style file with coordinates for d2io1f1.
(The format of our PDB-style files is described here.)

Timeline for d2io1f1: