Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (7 families) |
Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
Protein SUMO-2 [117816] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117817] (10 PDB entries) |
Domain d2io1b1: 2io1 B:15-88 [137537] automatically matched to d1wm2a_ mutant |
PDB Entry: 2io1 (more details), 2.6 Å
SCOP Domain Sequences for d2io1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io1b1 d.15.1.1 (B:15-88) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq lemededtidvfqq
Timeline for d2io1b1: