Lineage for d2io0b_ (2io0 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402301Protein SUMO-2 [117816] (1 species)
  7. 1402302Species Human (Homo sapiens) [TaxId:9606] [117817] (9 PDB entries)
    Uniprot P61956
  8. 1402305Domain d2io0b_: 2io0 B: [137536]
    Other proteins in same PDB: d2io0a1
    automated match to d1wm2a_
    complexed with so4

Details for d2io0b_

PDB Entry: 2io0 (more details), 2.3 Å

PDB Description: crystal structure of human senp2 in complex with presumo-2
PDB Compounds: (B:) Small ubiquitin-related modifier 2 precursor

SCOPe Domain Sequences for d2io0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io0b_ d.15.1.1 (B:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
lemededtidvfqqqtggvylehh

SCOPe Domain Coordinates for d2io0b_:

Click to download the PDB-style file with coordinates for d2io0b_.
(The format of our PDB-style files is described here.)

Timeline for d2io0b_: