Lineage for d2inda1 (2ind A:2-492)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 639101Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 639343Protein Toluene, o-xylene monooxygenase oxygenase subunit TouA [109788] (1 species)
    contains the TouB(TmoB)-binding YHS (sub)domain (Pfam PF04945) in the C-terminal part (401-450)
  7. 639344Species Pseudomonas stutzeri [TaxId:316] [109789] (5 PDB entries)
  8. 639347Domain d2inda1: 2ind A:2-492 [137527]
    Other proteins in same PDB: d2indb1, d2indc1
    automatically matched to d1t0qa_
    complexed with mn, p6g

Details for d2inda1

PDB Entry: 2ind (more details), 2.2 Å

PDB Description: mn(ii) reconstituted toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure
PDB Compounds: (A:) Toluene, o-xylene monooxygenase oxygenase subunit

SCOP Domain Sequences for d2inda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2inda1 a.25.1.2 (A:2-492) Toluene, o-xylene monooxygenase oxygenase subunit TouA {Pseudomonas stutzeri [TaxId: 316]}
smlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvsi
qrekdsgaysikaalerdgfvdradpgwvstmqlhfgaialeeyaastaearmarfakap
gnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmmm
trdsvavsimltfafetgftnmqflglaadaaeagdhtfaslissiqtdesrhaqqggps
lkilvengkkdeaqqmvdvaiwrswklfsvltgpimdyytplesrnqsfkefmlewivaq
ferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewleek
ypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqley
egrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgdd
ahdyewvkayq

SCOP Domain Coordinates for d2inda1:

Click to download the PDB-style file with coordinates for d2inda1.
(The format of our PDB-style files is described here.)

Timeline for d2inda1: