SCOPe 2.06: Domain d2incc_: 2inc C:

Lineage for d2incc_ (2inc C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.12: TmoB-like [110814] (2 families)
   possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.12.1: TmoB-like [110815] (1 protein)
   Pfam PF06234

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species)

7. Species Pseudomonas stutzeri [TaxId:316] [110817] (6 PDB entries)
   Uniprot O87799

8. Domain d2incc_: 2inc C: [137526]
   Other proteins in same PDB: d2inca_, d2incb_
   automated match to d1t0rc_
   complexed with fe, p6g

Details for d2incc_

PDB Entry: 2inc, 1.85 Å

PDB Description: native toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure

PDB Compounds: (C:) TouB protein

SCOPe Domain Sequences for d2incc_:

Sequence; same for both SEQRES and ATOM records:

>d2incc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

Timeline for d2incc_:

• d2incc_ first appeared in SCOP 1.73, called d2incc1
  
• d2incc_ appears in SCOPe 2.05
  
• d2incc_ appears in SCOPe 2.07
  
• d2incc_ appears in the current release, SCOPe 2.08