Lineage for d2in1b1 (2in1 B:3-164)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857031Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 857032Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 857214Family d.20.1.4: UFC1-like [143072] (1 protein)
  6. 857215Protein Ufm1-conjugating enzyme 1, UFC1 [143073] (1 species)
    aka cgi-126
  7. 857216Species Human (Homo sapiens) [TaxId:9606] [143074] (2 PDB entries)
    Uniprot Q9Y3C8 1-167
  8. 857218Domain d2in1b1: 2in1 B:3-164 [137522]
    automatically matched to 1YWZ A:1-167

Details for d2in1b1

PDB Entry: 2in1 (more details), 2.7 Å

PDB Description: Crystal Structure of the Human Ubiquitin fold conjugating enzyme 1 (Ufc1), Northeast Structural Genomics Target HR41
PDB Compounds: (B:) Ufm1-conjugating enzyme 1

SCOP Domain Sequences for d2in1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2in1b1 d.20.1.4 (B:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]}
deatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkeg
trwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfk
plwarnvpkfglahlmalglgpwlaveipdliqkgviqhkek

SCOP Domain Coordinates for d2in1b1:

Click to download the PDB-style file with coordinates for d2in1b1.
(The format of our PDB-style files is described here.)

Timeline for d2in1b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2in1a1