Lineage for d2imca_ (2imc A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1660932Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 1660933Protein Botulinum neurotoxin [55513] (4 species)
  7. 1660934Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (25 PDB entries)
    Uniprot P10845 1-419
  8. 1660952Domain d2imca_: 2imc A: [137513]
    automated match to d1xtga_
    complexed with zn

Details for d2imca_

PDB Entry: 2imc (more details), 2 Å

PDB Description: clostridium botulinum neurotoxin serotype a light chain, residues 1- 424
PDB Compounds: (A:) Botulinum neurotoxin A light-chain

SCOPe Domain Sequences for d2imca_:

Sequence, based on SEQRES records: (download)

>d2imca_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
ssglvprgshmqfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihnkiwviperdt
ftnpeegdlnpppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmllts
ivrgipfwggstidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfgh
evlnltrngygstqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihagh
rlygiainpnrvfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkf
kdiastlnkaksivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiyt
ednfvkffkvlnrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinn
mnftklkn

Sequence, based on observed residues (ATOM records): (download)

>d2imca_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
ssglvprgshmqfvnkqfnykdpvngvdiayikipqmqpvkafkihnkiwviperdtftn
peegdlnpppeqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgi
pfwggstidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnl
trngygstqyirfspdftfgfeeslgagkfatdpavtlahelihaghrlygiainpnrve
vsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkaksivgttaslqymknvf
kekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvlnrktylnfdkavfkin
ivpkvnytiydgfnlrntnlaanfngqnteinnmnftklkn

SCOPe Domain Coordinates for d2imca_:

Click to download the PDB-style file with coordinates for d2imca_.
(The format of our PDB-style files is described here.)

Timeline for d2imca_: