Lineage for d2imbb1 (2imb B:3-416)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729242Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (1 protein)
  6. 729243Protein Botulinum neurotoxin [55513] (3 species)
  7. 729244Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (8 PDB entries)
  8. 729257Domain d2imbb1: 2imb B:3-416 [137512]
    automatically matched to d1xtfa_
    complexed with ahl, zn

Details for d2imbb1

PDB Entry: 2imb (more details), 2.41 Å

PDB Description: clostridium botulinum neurotoxin serotype a light chain inhibited by l-arginine hydroxamate
PDB Compounds: (B:) Botulinum neurotoxin A light-chain

SCOP Domain Sequences for d2imbb1:

Sequence, based on SEQRES records: (download)

>d2imbb1 d.92.1.7 (B:3-416) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
fvnkqfnykdpvngvdiayikipnvgqmqpvkafkihnkiwviperdtftnpeegdlnpp
peakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggst
idtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngygs
tqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpnrv
fkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkaks
ivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvln
rktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftkl

Sequence, based on observed residues (ATOM records): (download)

>d2imbb1 d.92.1.7 (B:3-416) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
fvnkqfnykdpvngvdiayikipnmqpvkafkihnkiwviperdtftnpeegdlnppvsy
ydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggstidtelkvidt
ncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngygstqyirfspdf
tfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpnrvevsfeelrtf
gghdakfidslqenefrlyyynkfkdiastlnkaksivgttaslqymknvfkekyllsed
tsgkfsvdklkfdklykmlteiytednfvkffkvlnrktylnfdkavfkinivpkvnyti
ydgfnlrntnlaanfngqnteinnmnftkl

SCOP Domain Coordinates for d2imbb1:

Click to download the PDB-style file with coordinates for d2imbb1.
(The format of our PDB-style files is described here.)

Timeline for d2imbb1: