Lineage for d2imbb2 (2imb B:1-416)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529349Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2529350Protein Botulinum neurotoxin [55513] (4 species)
  7. 2529351Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (28 PDB entries)
    Uniprot P10845 1-419
  8. 2529384Domain d2imbb2: 2imb B:1-416 [137512]
    Other proteins in same PDB: d2imba3, d2imbb3
    automated match to d1xtga_
    complexed with ahl, zn

Details for d2imbb2

PDB Entry: 2imb (more details), 2.41 Å

PDB Description: clostridium botulinum neurotoxin serotype a light chain inhibited by l-arginine hydroxamate
PDB Compounds: (B:) Botulinum neurotoxin A light-chain

SCOPe Domain Sequences for d2imbb2:

Sequence, based on SEQRES records: (download)

>d2imbb2 d.92.1.7 (B:1-416) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
mqfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihnkiwviperdtftnpeegdln
pppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwgg
stidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngy
gstqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpn
rvfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnka
ksivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkv
lnrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftkl

Sequence, based on observed residues (ATOM records): (download)

>d2imbb2 d.92.1.7 (B:1-416) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
mqfvnkqfnykdpvngvdiayikipnmqpvkafkihnkiwviperdtftnpeegdlnppv
syydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggstidtelkvi
dtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngygstqyirfsp
dftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpnrvevsfeelr
tfgghdakfidslqenefrlyyynkfkdiastlnkaksivgttaslqymknvfkekylls
edtsgkfsvdklkfdklykmlteiytednfvkffkvlnrktylnfdkavfkinivpkvny
tiydgfnlrntnlaanfngqnteinnmnftkl

SCOPe Domain Coordinates for d2imbb2:

Click to download the PDB-style file with coordinates for d2imbb2.
(The format of our PDB-style files is described here.)

Timeline for d2imbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2imbb3