SCOPe 2.01: Domain d2im8b_: 2im8 B:

Lineage for d2im8b_ (2im8 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.26: YppE-like [140415] (1 family)
   flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3

5. Family a.24.26.1: YppE-like [140416] (3 proteins)
   Pfam PF08807; DUF1798

6. Protein Hypothetical protein YppE [140421] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140422] (2 PDB entries)
   Uniprot P50833 1-123

8. Domain d2im8b_: 2im8 B: [137507]
   automated match to d2hfia1
   complexed with po4

Details for d2im8b_

PDB Entry: 2im8, 2 Å

PDB Description: X-Ray Crystal Structure of Protein yppE from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR213.

PDB Compounds: (B:) Hypothetical protein yppE

SCOPe Domain Sequences for d2im8b_:

Sequence, based on SEQRES records:

>d2im8b_ a.24.26.1 (B:) Hypothetical protein YppE {Bacillus subtilis [TaxId: 1423]}
mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiar

Sequence, based on observed residues (ATOM records):

>d2im8b_ a.24.26.1 (B:) Hypothetical protein YppE {Bacillus subtilis [TaxId: 1423]}
mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
likvrrphkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiar

Timeline for d2im8b_:

• d2im8b_ first appeared in SCOP 1.73, called d2im8b1
  
• d2im8b_ was called d2im8b1 in SCOP 1.75
  
• d2im8b_ appears in SCOPe 2.02
  
• d2im8b_ appears in the current release, SCOPe 2.08