SCOPe 2.06: Domain d2ik8c1: 2ik8 C:61-181

Lineage for d2ik8c1 (2ik8 C:61-181)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158559] (9 PDB entries)

8. Domain d2ik8c1: 2ik8 C:61-181 [137486]
   Other proteins in same PDB: d2ik8a2, d2ik8b1, d2ik8c2, d2ik8d_
   automatically matched to d1kjya1
   complexed with alf, gdp, mg, so4

Details for d2ik8c1

PDB Entry: 2ik8, 2.71 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS16 and activated Gi alpha 1

PDB Compounds: (C:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2ik8c1:

Sequence, based on SEQRES records:

>d2ik8c1 a.66.1.1 (C:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Sequence, based on observed residues (ATOM records):

>d2ik8c1 a.66.1.1 (C:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlamtaelagvi
krlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt

Timeline for d2ik8c1:

• d2ik8c1 first appeared in SCOP 1.73
  
• d2ik8c1 appears in SCOPe 2.05
  
• d2ik8c1 appears in SCOPe 2.07
  
• d2ik8c1 appears in the current release, SCOPe 2.08