Lineage for d2ijnb2 (2ijn B:3-566)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2572036Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2572350Protein automated matches [190260] (24 species)
    not a true protein
  7. 2572444Species Hepatitis C virus subtype 1b [TaxId:31647] [187148] (4 PDB entries)
  8. 2572448Domain d2ijnb2: 2ijn B:3-566 [137479]
    Other proteins in same PDB: d2ijna3, d2ijnb3
    automated match to d1c2pb_
    complexed with 221

Details for d2ijnb2

PDB Entry: 2ijn (more details), 2.2 Å

PDB Description: Isothiazoles as active-site inhibitors of HCV NS5B polymerase
PDB Compounds: (B:) RNA polymerase NS5B

SCOPe Domain Sequences for d2ijnb2:

Sequence, based on SEQRES records: (download)

>d2ijnb2 e.8.1.4 (B:3-566) automated matches {Hepatitis C virus subtype 1b [TaxId: 31647]}
sytwtgalitpcaaeesklpinalsnsllrhhnmvyattsrsaglrqkkvtfdrlqvldd
hyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhihsv
wkdlledtvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvvstl
pqvvmgssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiyqc
cdlapearqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkasaa
craaklqdctmlvngddlvvicesagvqedaaslrafteamtrysappgdppqpeydlel
itscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlwar
milmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspgei
nrvasclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktklkltpipaa
sqldlsgwfvagysggdiyhslsr

Sequence, based on observed residues (ATOM records): (download)

>d2ijnb2 e.8.1.4 (B:3-566) automated matches {Hepatitis C virus subtype 1b [TaxId: 31647]}
sytwtgalitpcaaeesklpinalsnsllrhhnmvyattsrsaglrqkkvtfdrlqvldd
hyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhihsv
wkdlledtvtpidttimaknevfcvqrkparlivfpdlgvrvcekmalydvvstlpqvvm
gssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiyqccdlap
earqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkasaacraak
lqdctmlvngddlvvicesagvqedaaslrafteamtrysappgdppqpeydlelitscs
snvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlwarmilmt
hffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspgeinrvas
clrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktklkltpipaasqldl
sgwfvagysggdiyhslsr

SCOPe Domain Coordinates for d2ijnb2:

Click to download the PDB-style file with coordinates for d2ijnb2.
(The format of our PDB-style files is described here.)

Timeline for d2ijnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ijnb3