Lineage for d2ijcd1 (2ijc D:3-144)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650162Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 650163Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 650214Family a.152.1.3: Atu0492-like [140970] (2 proteins)
    duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family
  6. 650223Protein Hypothetical protein PA0269 [140973] (1 species)
  7. 650224Species Pseudomonas aeruginosa [TaxId:287] [140974] (2 PDB entries)
  8. 650229Domain d2ijcd1: 2ijc D:3-144 [137468]
    automatically matched to 2IJC A:2-144

Details for d2ijcd1

PDB Entry: 2ijc (more details), 2.05 Å

PDB Description: Structure of a Conserved Protein of Unknown Function PA0269 from Pseudomonas aeruginosa
PDB Compounds: (D:) hypothetical protein

SCOP Domain Sequences for d2ijcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ijcd1 a.152.1.3 (D:3-144) Hypothetical protein PA0269 {Pseudomonas aeruginosa [TaxId: 287]}
trlewakaspdayaamlglekalakaglerplielvylrtsqingcaycvnmhandarka
geteqrlqalcvwqetpyftpreraalawteqlarlsqgalphglldelrehfddkeiae
ltlavsainawnrfgvgmgmqp

SCOP Domain Coordinates for d2ijcd1:

Click to download the PDB-style file with coordinates for d2ijcd1.
(The format of our PDB-style files is described here.)

Timeline for d2ijcd1: