Lineage for d2ij5a1 (2ij5 A:5-396)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774742Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 774743Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 774744Family a.104.1.1: Cytochrome P450 [48265] (22 proteins)
  6. 774759Protein Cyp121 monooxygenase (P450 Mt2) [81865] (1 species)
  7. 774760Species Mycobacterium tuberculosis [TaxId:1773] [81866] (4 PDB entries)
  8. 774762Domain d2ij5a1: 2ij5 A:5-396 [137451]
    automatically matched to d1n40a_
    complexed with hem, so4

Details for d2ij5a1

PDB Entry: 2ij5 (more details), 1.6 Å

PDB Description: Crystal structure of cytochrome P450 CYP121, P212121 space group
PDB Compounds: (A:) Cytochrome P450 121

SCOP Domain Sequences for d2ij5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ij5a1 a.104.1.1 (A:5-396) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]}
vllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsmke
taaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslldnl
itegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinwdr
dieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfltt
alisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkgel
vlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieallk
kmpgvdlavpidqlvwrtrfqrriperlpvlw

SCOP Domain Coordinates for d2ij5a1:

Click to download the PDB-style file with coordinates for d2ij5a1.
(The format of our PDB-style files is described here.)

Timeline for d2ij5a1: