Lineage for d2ij0a2 (2ij0 A:94-194)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894514Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1894515Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1894690Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species)
  7. 1894691Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries)
  8. 1894712Domain d2ij0a2: 2ij0 A:94-194 [137446]
    Other proteins in same PDB: d2ij0a1, d2ij0b1, d2ij0c1, d2ij0e_
    automated match to d2tssa2

Details for d2ij0a2

PDB Entry: 2ij0 (more details), 2.25 Å

PDB Description: Structural basis of T cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d2ij0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ij0a2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOPe Domain Coordinates for d2ij0a2:

Click to download the PDB-style file with coordinates for d2ij0a2.
(The format of our PDB-style files is described here.)

Timeline for d2ij0a2: