Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries) |
Domain d2ij0a2: 2ij0 A:94-194 [137446] Other proteins in same PDB: d2ij0a1, d2ij0b1, d2ij0c1, d2ij0e_ automated match to d2tssa2 |
PDB Entry: 2ij0 (more details), 2.25 Å
SCOPe Domain Sequences for d2ij0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ij0a2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]} lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqihglyrssdktggy wkitmndgstyqsdlskkfeyntekppinideiktieaein
Timeline for d2ij0a2:
View in 3D Domains from other chains: (mouse over for more information) d2ij0b1, d2ij0b2, d2ij0c1, d2ij0e_ |