SCOP 1.73: Domain d2iiza1: 2iiz A:5-310

Lineage for d2iiza1 (2iiz A:5-310)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.14: Dyp-type peroxidase-like [143265] (3 proteins)
   Pfam PF04261

6. Protein Melanin biosynthesis protein TyrA [143270] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [143271] (2 PDB entries)

8. Domain d2iiza1: 2iiz A:5-310 [137444]
   automatically matched to 2HAG A:5-311
   complexed with edo, hem, ipa, na

Details for d2iiza1

PDB Entry: 2iiz, 2.3 Å

PDB Description: crystal structure of putative melanin biosynthesis protein tyra with bound heme (np_716371.1) from shewanella oneidensis at 2.30 a resolution

PDB Compounds: (A:) Melanin biosynthesis protein TyrA, putative

SCOP Domain Sequences for d2iiza1:

Sequence; same for both SEQRES and ATOM records:

>d2iiza1 d.58.4.14 (A:5-310) Melanin biosynthesis protein TyrA {Shewanella oneidensis [TaxId: 70863]}
nmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsafngfva
iganywdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvaneisqm
fedlvelveeergfrfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsyihvqk
yahnlskwhrlplkkqediigrtkqdnieyesedkpltshikrvnlkdengksieilrqs
mpygslkeqglmfistcrtpdhfekmlhsmvfgdgagnhdhlmhftsaltgssffapsld
flmqfd

Timeline for d2iiza1:

• d2iiza1 is new in SCOP 1.73
  
• d2iiza1 appears in SCOP 1.75
  
• d2iiza1 appears in the current release, SCOPe 2.08, called d2iiza_