Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (8 proteins) Pfam PF00567 |
Protein p53-binding protein 1, 53BP1 [110163] (1 species) duplication; contains two Tudor domains in tandem |
Species Human (Homo sapiens) [TaxId:9606] [110164] (18 PDB entries) Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606 |
Domain d2ig0a2: 2ig0 A:1538-1603 [137351] automated match to d1ssfa2 protein/DNA complex; complexed with so4 |
PDB Entry: 2ig0 (more details), 1.7 Å
SCOPe Domain Sequences for d2ig0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ig0a2 b.34.9.1 (A:1538-1603) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]} ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr eqyglg
Timeline for d2ig0a2: