SCOP 1.75: Domain d2ifqb1: 2ifq B:1-105

Lineage for d2ifqb1 (2ifq B:1-105)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (22 PDB entries)

8. Domain d2ifqb1: 2ifq B:1-105 [137344]
   automatically matched to d1auc__
   complexed with eoh, snc

Details for d2ifqb1

PDB Entry: 2ifq, 1.2 Å

PDB Description: Crystal structure of S-nitroso thioredoxin

PDB Compounds: (B:) thioredoxin

SCOP Domain Sequences for d2ifqb1:

Sequence; same for both SEQRES and ATOM records:

>d2ifqb1 c.47.1.1 (B:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv

Timeline for d2ifqb1:

• d2ifqb1 first appeared in SCOP 1.73
  
• d2ifqb1 is called d2ifqb_ in SCOPe 2.01
  
• d2ifqb1 appears in the current release, SCOPe 2.08, called d2ifqb_