Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (8 families) less regular structure consisting of variable repeats |
Family c.10.2.7: Ngr ectodomain-like [75142] (6 proteins) this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain |
Protein High affinity nerve growth factor receptor, N-terminal domain [141992] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141993] (1 PDB entry) Uniprot P04629 36-191 |
Domain d2ifgb3: 2ifg B:36-191 [137340] Other proteins in same PDB: d2ifga1, d2ifga2, d2ifgb1, d2ifgb2, d2ifge1, d2ifgf1 automatically matched to 2IFG A:36-191 complexed with bma, man, nag, ndg |
PDB Entry: 2ifg (more details), 3.4 Å
SCOP Domain Sequences for d2ifgb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ifgb3 c.10.2.7 (B:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} cpdaccphgssglrctrdgaldslhhlpgaenltelyienqqhlqhlelrdlrglgelrn ltivksglrfvapdafhftprlsrlnlsfnaleslswktvqglslqelvlsgnplhcsca lrwlqrweeeglggvpeqklqchgqgplahmpnasc
Timeline for d2ifgb3: