SCOP 1.73: Domain d2ieaa3: 2iea A:701-886

Lineage for d2ieaa3 (2iea A:701-886)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families)

5. Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)

6. Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species)
   E1A and E1B fused together in a single-chain protein

7. Species Escherichia coli [TaxId:562] [75240] (6 PDB entries)

8. Domain d2ieaa3: 2iea A:701-886 [137296]
   Other proteins in same PDB: d2ieaa1, d2ieaa2, d2ieab1, d2ieab2
   automatically matched to d1l8aa3
   complexed with mg, tdp

Details for d2ieaa3

PDB Entry: 2iea, 1.85 Å

PDB Description: e. coli pyruvate dehydrogenase

PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOP Domain Sequences for d2ieaa3:

Sequence; same for both SEQRES and ATOM records:

>d2ieaa3 c.48.1.1 (A:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli [TaxId: 562]}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla

Timeline for d2ieaa3:

• d2ieaa3 is new in SCOP 1.73
  
• d2ieaa3 appears in SCOP 1.75
  
• d2ieaa3 appears in the current release, SCOPe 2.08