Lineage for d2ie3a1 (2ie3 A:9-589)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775365Family a.118.1.2: HEAT repeat [48385] (2 proteins)
    Pfam PF02985
  6. 775366Protein Constant regulatory domain of protein phosphatase 2a, pr65alpha [48386] (1 species)
  7. 775367Species Human (Homo sapiens) [TaxId:9606] [48387] (8 PDB entries)
  8. 775370Domain d2ie3a1: 2ie3 A:9-589 [137290]
    Other proteins in same PDB: d2ie3c1
    automatically matched to d1b3ua_
    complexed with acb, add, cab, mn

Details for d2ie3a1

PDB Entry: 2ie3 (more details), 2.8 Å

PDB Description: Structure of the Protein Phosphatase 2A Core Enzyme Bound to Tumor-inducing Toxins
PDB Compounds: (A:) Protein Phosphatase 2, regulatory subunit A (PR 65), alpha isoform

SCOP Domain Sequences for d2ie3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ie3a1 a.118.1.2 (A:9-589) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}
slypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevlla
laeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahf
vplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaask
lgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptl
rqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvke
fcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllpl
flaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieymp
llagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvla
msgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkig
pildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla

SCOP Domain Coordinates for d2ie3a1:

Click to download the PDB-style file with coordinates for d2ie3a1.
(The format of our PDB-style files is described here.)

Timeline for d2ie3a1: