Lineage for d2icwd2 (2icw D:13-81)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1642339Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1642432Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries)
  8. 1642440Domain d2icwd2: 2icw D:13-81 [137248]
    Other proteins in same PDB: d2icwa1, d2icwb1, d2icwb2, d2icwd1, d2icwe1, d2icwe2, d2icwg_, d2icwh_, d2icwj1, d2icwl_
    automatically matched to d1k2da2

Details for d2icwd2

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
PDB Compounds: (D:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2icwd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icwd2 d.19.1.1 (D:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp

SCOPe Domain Coordinates for d2icwd2:

Click to download the PDB-style file with coordinates for d2icwd2.
(The format of our PDB-style files is described here.)

Timeline for d2icwd2: