Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.14: Adenine deaminase-like [141816] (1 protein) |
Protein Putative adenine deaminase EF0837 [141817] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [141818] (1 PDB entry) Uniprot Q837K0 53-319 |
Domain d2icsa2: 2ics A:55-321 [137242] Other proteins in same PDB: d2icsa1 complexed with ade, zn |
PDB Entry: 2ics (more details), 2.3 Å
SCOPe Domain Sequences for d2icsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icsa2 c.1.9.14 (A:55-321) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} gwiddhvhcfekmalyydypdeigvkkgvttvidagttgaenihefydlaqqaktnvfgl vniskwgivaqdeladlskvqaslvkkaiqelpdfvvgikarmsrtvigdngitplelak qiqqenqeiplmvhigsapphldeilalmekgdvlthcfngkengildqatdkikdfawq aynkgvvfdighgtdsfnfhvaetalregmkaasistdiyirnrengpvydlattmeklr vvgydwpeiiekvtkapaenfhltqkg
Timeline for d2icsa2: