SCOP 1.73: Domain d2icaa1: 2ica A:129-306

Lineage for d2icaa1 (2ica A:129-306)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (5 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)

6. Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53303] (16 PDB entries)

8. Domain d2icaa1: 2ica A:129-306 [137236]
   automatically matched to d1rd4a_
   complexed with 2ic

Details for d2icaa1

PDB Entry: 2ica, 1.56 Å

PDB Description: cd11a (lfa1) i-domain complexed with bms-587101 aka 5-[(5s, 9r)-9-(4- cyanophenyl)-3-(3,5-dichlorophenyl)-1-methyl-2,4-dioxo-1,3,7- triazaspiro [4.4]non-7-yl]methyl]-3-thiophenecarboxylicacid

PDB Compounds: (A:) Integrin alpha-L

SCOP Domain Sequences for d2icaa1:

Sequence; same for both SEQRES and ATOM records:

>d2icaa1 c.62.1.1 (A:129-306) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
nvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyvk
rkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgni
daakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkki

Timeline for d2icaa1:

• d2icaa1 is new in SCOP 1.73
  
• d2icaa1 appears in SCOP 1.75
  
• d2icaa1 appears in the current release, SCOPe 2.08, called d2icaa2