SCOPe 2.04: Domain d2ic2a1: 2ic2 A:466-572

Lineage for d2ic2a1 (2ic2 A:466-572)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Hedgehog receptor iHog [141061] (1 species)
   Cg9211-PA

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141062] (3 PDB entries)
   Uniprot Q9VM64 466-572! Uniprot Q9VM64 573-667

8. Domain d2ic2a1: 2ic2 A:466-572 [137233]
   complexed with so4

Details for d2ic2a1

PDB Entry: 2ic2, 1.3 Å

PDB Description: crystal structure of the first fniii domain of ihog

PDB Compounds: (A:) cg9211-pa

SCOPe Domain Sequences for d2ic2a1:

Sequence, based on SEQRES records:

>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ypptppnvtrlsdesvmlrwmvprndglpivifkvqyrmvgkrknwqttndnipygkpkw
nselgksftasvtdlkpqhtyrfrilavysnndnkesntsakfylqp

Sequence, based on observed residues (ATOM records):

>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ypptppnvtrlsvmlrwmvprndglpivifkvqyrmvgnwqttndnipygkpkwnselgk
sftasvtdlkpqhtyrfrilavysnndnkesntsakfylqp

Timeline for d2ic2a1:

• d2ic2a1 first appeared in SCOP 1.73
  
• d2ic2a1 appears in SCOPe 2.03
  
• d2ic2a1 appears in SCOPe 2.05
  
• d2ic2a1 appears in the current release, SCOPe 2.08