Lineage for d2ibzi_ (2ibz I:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631382Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 2631383Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 2631420Protein automated matches [190326] (4 species)
    not a true protein
  7. 2631421Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187144] (1 PDB entry)
  8. 2631422Domain d2ibzi_: 2ibz I: [137228]
    Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzx_, d2ibzy_
    automated match to d1ezvi_
    complexed with fes, hem, sma, uq6

Details for d2ibzi_

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (I:) Ubiquinol-cytochrome c reductase complex 7.3 kDa protein

SCOPe Domain Sequences for d2ibzi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibzi_ f.23.14.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

SCOPe Domain Coordinates for d2ibzi_:

Click to download the PDB-style file with coordinates for d2ibzi_.
(The format of our PDB-style files is described here.)

Timeline for d2ibzi_: