Lineage for d2ibzg_ (2ibz G:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254451Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 2254452Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 2254453Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 2254454Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81505] (8 PDB entries)
  8. 2254458Domain d2ibzg_: 2ibz G: [137226]
    Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_
    automated match to d1ezvg_
    complexed with fes, hem, sma, uq6

Details for d2ibzg_

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (G:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d2ibzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibzg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
pagiywywwkngneyneflyskagreelervnv

SCOPe Domain Coordinates for d2ibzg_:

Click to download the PDB-style file with coordinates for d2ibzg_.
(The format of our PDB-style files is described here.)

Timeline for d2ibzg_: