![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) ![]() location - matrix side of the bc1 complex |
![]() | Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
![]() | Protein automated matches [190325] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187143] (1 PDB entry) |
![]() | Domain d2ibzf_: 2ibz F: [137225] Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_ automated match to d1ezvf_ complexed with fes, hem, sma, uq6 |
PDB Entry: 2ibz (more details), 2.3 Å
SCOPe Domain Sequences for d2ibzf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibzf_ f.27.1.1 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn ievsk
Timeline for d2ibzf_: