SCOPe 2.01: Domain d2ibzf_: 2ibz F:

Lineage for d2ibzf_ (2ibz F:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein automated matches [190325] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187143] (1 PDB entry)

8. Domain d2ibzf_: 2ibz F: [137225]
   Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_
   automated match to d1ezvf_
   complexed with fes, hem, sma, uq6

Details for d2ibzf_

PDB Entry: 2ibz, 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin

PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOPe Domain Sequences for d2ibzf_:

Sequence; same for both SEQRES and ATOM records:

>d2ibzf_ f.27.1.1 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
ievsk

Timeline for d2ibzf_:

• d2ibzf_ first appeared in SCOP 1.73, called d2ibzf1
  
• d2ibzf_ was called d2ibzf1 in SCOP 1.75
  
• d2ibzf_ appears in SCOPe 2.02
  
• d2ibzf_ appears in the current release, SCOPe 2.08