SCOP 1.75: Domain d2ibzf1: 2ibz F:3-127

Lineage for d2ibzf1 (2ibz F:3-127)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81521] (7 PDB entries)

8. Domain d2ibzf1: 2ibz F:3-127 [137225]
   Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzg1, d2ibzh1, d2ibzi1, d2ibzx1, d2ibzy1
   automatically matched to d1ezvf_
   complexed with fes, hem, sma, uq6

Details for d2ibzf1

PDB Entry: 2ibz, 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin

PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOP Domain Sequences for d2ibzf1:

Sequence; same for both SEQRES and ATOM records:

>d2ibzf1 f.27.1.1 (F:3-127) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
ievsk

Timeline for d2ibzf1:

• d2ibzf1 first appeared in SCOP 1.73
  
• d2ibzf1 is called d2ibzf_ in SCOPe 2.01
  
• d2ibzf1 appears in the current release, SCOPe 2.08, called d2ibzf_